Luận án Nghiên cứu hệ gen của virus cúm A/H5N1 phân lập từ gà nuôi tại Hậu Giang

MỤC LỤC

Trang

DANH MỤC CÁC KÝ HIỆU, CHỮ VIẾT TẮT VÀ GIẢI NGHĨA . VI

DANH MỤC CÁC BẢNG . VIII

DANH MỤC CÁC HÌNH . XI

MỞ ĐẦU . 1

CHƯƠNG 1: TỔNG QUAN TÀI LIỆU . 4

1.1. Đại cương về bệnh cúm gia cầm . 4

1.1.1. Lịch sử bệnh cúm gia cầm . 4

1.1.2. Tình hình dịch cúm gia cầm A/H5N1 trên thế giới . 5

1.1.3. Tình hình dịch cúm gia cầm A/H5N1 ở Việt Nam . 7

1.1.4. Nguyên nhân gây bệnh. 9

1.1.5. Cơ chế sinh bệnh . 13

1.1.6. Triệu chứng lâm sàng . 15

1.1.7. Bệnh tích . 16

1.1.8. Chẩn đoán bệnh. 18

1.1.9. Phòng chống bệnh cúm gia cầm . 20

1.2. Sinh học phân tử virus cúm A . 24

1.2.1. Hệ gen của virus cúm A. 24

1.2.2. Protein của virus - cấu trúc và chức năng . 26

1.2.3. Cơ chế phân tử quá trình xâm nhiễm và nhân lên của virus cúm A 36

1.2.4. Các phương thức biến đổi kháng nguyên của virus cúm A . 38

1.3. Tiến hóa hệ gen virus cúm A/H5N1 . 42

1.3.1. Sự tiến hóa của virus cúm A/H5N1 . 42

1.3.2. Sự xâm nhập các genotype của virus cúm A/H5N1vào Việt Nam. 44

1.3.3. Sự biến đổi thành phần hemagglutinin (HA) tạo nên các nhóm

kháng nguyên (clade) của virus cúm A/H5N1 tại Việt Nam. 47IV

1.4. Phản ứng RT-PCR trong nghiên cứu virus cúm A . 49

1.5. Một số nghiên cứu về sinh học phân tử virus cúm A/H5N1 tại ViệtNam . 50

1.6. Tầm quan trọng của việc giải mã hệ gen virus cúm A/H5N1 . 54

CHƯƠNG 2: NỘI DUNG, NGUYÊN LIỆU VÀ PHƯƠNG PHÁPNGHIÊN CỨU. 56

2.1. Đối tượng nghiên cứu . 56

2.2. Địa điểm và thời gian nghiên cứu . 56

2.3. Nội dung nghiên cứu . 56

2.3.1. Giải trình tự toàn b ộ hệ gen chủng virus cúm A/H5N1 (CkHG4)

phân lập từ gà Hậu Giang . 56

2.3.2. Phân tích so sánh thành phần gen, mối quan hệ nguồn gốc phả

hệ chủng CkHG4 với các chủng của Việt Nam và thế giới . 56

2.4. Vật liệu nghiên cứu . 56

2.4.1. Nguyên liệu . 56

2.4.2. Dụng cụ và thiết bị . 57

2.4.3. Hóa chất . 57

2.4.4. Các dung dịch và môi trường . 57

2.5. Phương pháp nghiên cứu . 58

2.5.1. Phương pháp tách chiết RNA tổng số . 58

2.5.2. Phương pháp RT-PCR . 59

2.5.3. Phương pháp kiểm tra sản phẩm RT-PCR . 63

2.5.4. Phương pháp tinh sạch sản phẩm RT-PCR . 63

2.5.5. Phương pháp dòng hóa. 64

2.5.6. Phương pháp giải trình tự . 67

2.5.7. Phương pháp xử lý số liệu. 69

CHƯƠNG 3: KẾT QUẢ VÀ THẢO LUẬN . 70

3.1. Kết quả giải mã hệ gen virus cúm A/H5 N1 chủng CkHG4 . 70

3.1.1. Kết quả tách RNA tổng số . 70V

3.1.2. Kết quả giải trình tự các gen kháng nguyên HA (H5)

và NA (N1) . 71

3.1.2.1. Giải trình tự gen H5 (HA) . 71

3.1.2.2. Giải trình tự gen N1 (NA) . 73

3.1.3. Kết quả giải trình tự các gen polymerase . 75

3.1.3.1. Giải trình tự gen PB2 . 75

3.1.3.2. Giải trình tự gen PB1 . 76

3.1.3.3. Giải trình tự gen PA . 77

3.1.4. Kết quả giải trình tự các gen NP, M và NS. 79

3.1.4.1. Giải trình tự gen NP . 79

3.1.4.2. Giải trình tự gen M. 79

3.1.4.3. Giải trình tự gen NS . 80

3.2. Phân tích so sánh thành phần gen, mối quan hệ nguồn gốc phả hệ của

chủng CkHG4 với các chủng của Việt Nam và thế giới . 83

3.2.1. Phân tích gen H5 . 84

3.2.2. Phân tích gen N1 . 93

3.2.3. Phân tích gen PB2 . 102

3.2.4. Phân tích gen PB1 và PB1-F2. 106

3.2.5. Phân tích gen PA. 112

3.2.6. Phân tích gen NP . 117

3.2.7. Phân tích gen M . 120

3.2.8. Phân tích gen NS. 124

3.3. Thảo luận chung . 131

KẾT LUẬN VÀ KIẾN NGHỊ . 136

CÁC CÔNG TRÌNH ĐÃ CÔNG BỐ LIÊN QUAN ĐẾN

LUẬN ÁN. 138

TÀI LIỆU THAM KHẢO . 139

PHỤ LỤC

pdf127 trang | Chia sẻ: lavie11 | Ngày: 18/12/2020 | Lượt xem: 25 | Lượt tải: 0download
Bạn đang xem trước 20 trang tài liệu Luận án Nghiên cứu hệ gen của virus cúm A/H5N1 phân lập từ gà nuôi tại Hậu Giang, để xem tài liệu hoàn chỉnh bạn click vào nút DOWNLOAD ở trên
..............V.....R...................................Y... : 236 Dk-Hubei-4 : ......................................................................D.V.........................................Y... : 236 Ck-India-N : ................Q.....................................................................................I...........Y... : 236 360 * 380 * 400 * 420 * 440 * Ck-VN-HG4- : WDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKESTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK- : 449 Ck-VN-29-0 : ...........R..............................................................S....................- : 449 VN-HG-207- : ...............................................................................................- : 449 VN-HG-178- : ......I...................................................................S....................- : 449 Ck-VN-CT-0 : ...............................................................................................- : 449 Ck-VN-TG-0 : ...............................................................................................- : 449 Ck-VN-DT-1 : ...............................................................................................- : 449 Ck-VN-30-0 : ......S........................................................................................- : 449 Ck-VN-5-03 : ..............................................................................G................- : 449 Dk-VN-11-0 : ...............................................................................................- : 449 Ck-VN-NCVD : ...............................................................................................- : 449 VN-CL2009- : ..........................................................................................------ : 444 MDk-VN-145 : ..........................................................................D....S..............Q- : 449 Dk-VN-HaiP : ...........N.............................N.....................................S...............- : 449 Dk-VN-50-0 : ......S......................................................V.................S...............- : 449 Dk-VN-BL-0 : ...........................................................G...............G...................- : 449 Dk-VN-17A- : ...........................................................G..............SG...................- : 449 Ck-VN-NCVD : .......G............................................V...................................V......- : 449 Ck-Indo-BL : .......G.......................................................................S...............- : 449 Ck-Thailan : .G.............................................................................................- : 449 Ck-TL-CK-1 : .........................................N....................................................-- : 448 Ck-TL-NP-1 : .......G...N..M................................................................S............---- : 446 Dk-TL-KU-5 : .......G...N..M................................................................S...............- : 449 Ck-Guangxi : ......S........................................................................S...............- : 449 Ck-Hunan-8 : ...........E...................................................A...............S...............- : 449 Dk-Hubei-4 : .......G.......................................................................................- : 449 Ck-India-N : ......AG...............................................Q.......................S...............- : 449 Phụ lục 6: Đột biến trượt-xóa nucleotide (A) và amino acid (B) của gen N1 theo thời gian tiến hóa (chỉ minh họa vùng đột biến) (8 chủng trên cùng phân lập trước năm 2003; 6 chủng tiếp theo (đóng khung) phân lập ở Hồng Kông năm 1997; 27 chủng bên dưới phân lập trong các năm 2003-2009, trong đó có chủng CkHG4 (in đậm)) C ác ch ủ n g tr ư ớ c 20 03 C ác ch ủ n g 20 03 -2 0 09 A. ĐỘT BIẾN TRƯỢT-XÓA NUCLEOTIDE TRONG GEN N1 120 * 140 * 160 * 180 * 200 * 220 Ck-Scotlan : AATTCAGACTGGAAATCAAAACCAACCTGAAATATGCAATCAAAGCATCATTACTTACGAGAACAACACTTGGGTGAATCAAACATATGTTAACATCAGCAATACTAACT : 220 Gs-GD-1-96 : AATTCAGACAGGGAATCAACACCAAGCTGAACCATGCAATCAAAGCATTATTACTTATGAAAACAACACCTGGGTAAATCAAACATATGTCAACATCAGCAATACCAATT : 220 Ck-Hubei-w : ATTTCAGACAGGGAATCAACACCAGGCTGAACCATGCAATCAAAGCATTATTACTTATGAAAACAACACCTGGGTAAATCAGACATATGTCAACATCAGCAATACCAATT : 220 Dk-Guangxi : AATTCAGACAAGGAACCAACACCAAGCTGAACCATGCAATCAAAGCATCATTACTTATGAAAACAACACCTGGGTAAATCAGACATATGTCAACATCAGCAATACCAATT : 220 Dk-HK-2986 : AATTCAGACAGGGAATCAACACCAAGCTGAACCATGCAATCAAAGCATTATTACTTATGAAAACAACACCTGGGTAAATCAGACATATGTCAACATCAGCAATACCAATT : 220 Dk-GD-07-2 : AATTCAGACAGGGAATCAACACCAAGCTGAACCATGCAATCAAAGCATTATTACTTATGAAAACAACACCTGGGTAAATCAGACATATGTCAACATCGGCAATACCAATT : 220 Ck-HK-YU56 : AATTCAGAAAATGAACCAACACCAAACTGAACCATGCAATCAAAGCATCATTACTTATGAAAACAACACCTGGGTAAATCAGACATATGTCAACATCAGCAATACCAATT : 220 Dk-Fujian- : AATTCAGACAGGGAATCAACACCAAACTGAACCATGCAATCAAAGCATTATTACTTATGAAAACAACACCTGGGTAAATCAGACATATGTCAACATCAGCAATACCAATT : 220 Ck-HK-220- : AATTCAAACTTGGCATCCAAACCAGCCTGAACCATGCAATCAAAGC---------------------------------------------------------ATCAATT : 163 HK-486-97A : AATTAAAACTTGGCACCCAAACCAGCCTGAACCATGCAACCAAAGC---------------------------------------------------------ATCAATT : 163 HK-482-97A : AATTAAAACTTGGCACCCAAACCAGCCTGAACCATGCAATCAAAGC---------------------------------------------------------ATCAATT : 163 HK-538-97A : AATTAAAACTTGGCACCCAAACCAGCCTGAACCATGCAAACAAAGC---------------------------------------------------------ATCAATT : 163 HK-491-97A : AATTCAAGCTTGGCATCCAAACCAGCCTGAACCATGCAATCAAAGC---------------------------------------------------------ATCAATT : 163 HK-503-97A : AATTCAAGCTTGGCATTCAAACCAGCCTGAACCATGCAATCAAAGC---------------------------------------------------------ATCAATT : 163 Ck-VN-HG4- : AATTCACACAGGGAATCAACACCAAGCTGAACCA------------------------------------------------------------ATCAGCAATACTAATT : 160 Ck-VN-29-0 : AATTCACACAGGGAATCAACACCAAGCTGAGCCA------------------------------------------------------------ATCAGCAATACTAATC : 160 VN-HG-207- : AATTCACACAGGGAATCAACACCAAGCTGAACCA------------------------------------------------------------ATCAGCAATACTAATT : 160 VN-HG-178- : AATTCACACAGGGAATCAACACCAAGCTGAACCA------------------------------------------------------------ATCAGCAATACTAATT : 160 Ck-VN-CT-0 : AATTCACACAGGGAATCAACACCAAGCTGAACCA------------------------------------------------------------ATCAGCAATACTAATT : 160 Ck-VN-TG-0 : AATTCACACAGGGAATCAACACCAAGCTGAACCA------------------------------------------------------------ATCAGCAATACTAATT : 160 Ck-VN-DT-1 : AATTCACACAGGGAATCAACACCAAGCTGAACCA------------------------------------------------------------ATCAGCAATACTAATT : 160 Ck-VN-30-0 : AATTCACACAGGGAATCAACACCAAGCTGAACCA------------------------------------------------------------ATCAGCAATACTAATT : 160 Ck-VN-5-03 : AATTCACACAGGGAATCAACACCAAGCTGAACCA------------------------------------------------------------ATCAGCAATACTAATT : 160 Dk-VN-11-0 : AATTCACACAGGGAATCAACACCAAGCTGAACCA------------------------------------------------------------ATCAGCAATACTAATT : 160 Ck-VN-NCVD : AATTCACACAGGGAATCAACACCAAGCTGAACCA------------------------------------------------------------ATCAGCAATACTAATT : 160 VN-CL2009- : AATTAACACAGGGAATCAACACCAAGCTGAACCA------------------------------------------------------------ATCAGCAATGCTAATT : 160 MDk-VN-145 : AATTCAGACAGGGAATCAACACCAAGTTGAACCA------------------------------------------------------------ATCAGCAATACTAATT : 160 Dk-VN-HaiP : AATTCAAACAGGGAATCAACACCAAGCTGAACCA------------------------------------------------------------ATCAGAAATACTAATT : 160 Dk-VN-50-0 : AATTCAGACAGGGAATCAAAACCAAGTTGAGCCA------------------------------------------------------------ATCATCAATACTAATT : 160 Dk-VN-BL-0 : AATTCACACAGGGAATCAACACCAAGCTGAGCCA------------------------------------------------------------ATCAGCAATACTAATT : 160 Dk-VN-17A- : AATTCACACAGGGAATCAACACCAAGCTGAGCCA------------------------------------------------------------ATCAGCAATACTAATT : 160 Ck-VN-NCVD : AATTCAGACAGAGAATCAATGCCAAGCTGAATCG------------------------------------------------------------ATCAGCAATACTAAAT : 160 Ck-Indo-BL : AATTCAGACAGGGAATCAACACCAAGCTGAATCA------------------------------------------------------------ATCAGCAATACTAACC : 160 Ck-Thailan : AATTCACACAGGGAATCAACACAAAGCTGAACCA------------------------------------------------------------ATCAGCAATACTAATT : 160 Ck-TL-CK-1 : AATTCACACAGGGAATCAACAGAAAGCTGAACCA------------------------------------------------------------ATCAGCAATACTAATT : 160 Ck-Guangxi : AATTCAGACAGGGAATCTAAACCAAGTTGAACCA------------------------------------------------------------ATCAGCAATACTAATT : 160 Ck-TL-NP-1 : AATTCAAACAGGGAATCAACACCAAGCTGAACCA------------------------------------------------------------ATCAGAAATACTAATT : 160 Dk-TL-KU-5 : AATTCAAACAGGGAATCAACACCAAGCTGAACCA------------------------------------------------------------ATCAGAAATACTAATT : 160 Ck-Hunan-8 : AATTCAAACAGGGAATCAACACCAAGCTGAACCA------------------------------------------------------------ATCAGAAATACTAATT : 160 Dk-Hubei-4 : AATTCAGACAGAGAATCAACACCAAGCTGAACCA------------------------------------------------------------ATCAGCAATACCAATT : 160 Ck-India-N : AGTTCAGACAATGAATCAACGCCAAGCTGAACCA------------------------------------------------------------ATCAGCAGTAGCAAAT : 160 Các chủng Hồng Kông (1997) C ác ch ủ n g tr ư ớ c 20 03 C ác ch ủ n g 20 03 -2 0 09 C ác ch ủ n g tr ư ớ c 20 03 C ác ch ủ n g 20 03 -2 0 09 B. ĐỘT BIẾN TRƯỢT-XÓA AMINO ACID TRONG CHUỖI POLYPEPTIDE CỦA N1 * 20 * 40 * 60 * 80 * 100 * Ck-Scotlan : MNPNQKIITIGSICMIVGIISLILQIGNIISIWVSHSIQTGNQNQPEICNQSIITYENNTWVNQTYVNISNTNFVTEQALAPVALAGNSSLCPISGWAIYSKDNGIRIGS : 110 Gs-GD-1-96 : MNPNQKIITIGSICMVVGIISLMLQIGNIISIWVSHSIQTGNQHQAEPCNQSIITYENNTWVNQTYVNISNTNFLTEKAVASVTLAGNSSLCPISGWAVHSKDNGIRIGS : 110 Ck-Hubei-w : MNPNQKITTIGSICMVLGIVSLMLQMGNIISIWVSHSFQTGNQHQAEPCNQSIITYENNTWVNQTYVNISNTNFLTEKAVASVTLAGNSSLCPISGWAVYSKDNGIRIGS : 110 Dk-Guangxi : MNPNQKIITIGSICMVIGMVSLVLQIGNMISIWASHSIQTRNQHQAEPCNQSIITYENNTWVNQTYVNISNTNFLTEKAVASITLSGNSSLCPISGWAVYSKDNGIRIGS : 110 Dk-HK-2986 : MNPNQKIITIGSICMVIGIVSLMLQIGNIISIWVSHSIQTGNQHQAEPCNQSIITYENNTWVNQTYVNISNTNFLTEKAVASVTLAGNSSLCPISGWAVYSKDNGIRIGS : 110 Dk-GD-07-2 : MNPNQKIITIGSICMVIGIVSLMLQIGNIISIWVSHSIQTGNQHQAEPCNQSIITYENNTWVNQTYVNIGNTNFLTEKAVASVTLAGNSSLCPISGWAVYSKDNGIRIGS : 110 Ck-HK-YU56 : MNPNQKIMTIGSICMVIGMISLVLQIGNMISIWASHSIQKMNQHQTEPCNQSIITYENNTWVNQTYVNISNTNFLTEKVVASIALSGNSSLCPISGWAVYSKDNGIRIGS : 110 Dk-Fujian- : MNPNQKITTIGSICMVIGIVSLMLQIGNIISIWVSHSIQTGNQHQTEPCNQSIITYENNTWVNQTYVNISNTNFLTEKAVASVTLAGNSSLCPISGWAVYSKDNGIRIGS : 110 Ck-HK-220- : MNPNQKIITIGSICMVVGIISLMLQIGNIISVWVSHIIQTWHPNQPEPCNQS-------------------INFYTEQAAASVTLAGNSSLCPISGWAIYSKDNSIRIGS : 91 HK-486-97A : MNPNQKIITIGSICMVVGIINLMLQIGNTISVWVSHIIKTWHPNQPEPCNQS-------------------INFYTEQAAASVTLAGNSSLCPISGWAIYSKDNSIRIGS : 91 HK-482-97A : MNPNQKIITIGSICMVVGIISLMLQIGNTISVWVSHIIKTWHPNQPEPCNQS-------------------INFYTEQAAASVTLAGNSSLCPISGWAIYSKDNSIRIGS : 91 HK-538-97A : MNPNQKIITIGSICMVVGIISLMLQIGNTISVWVSHIIKTWHPNQPEPCKQS-------------------INFYTEQAAASVTLAGNSSLCPISGWAIYSKDNSIRIGS : 91 HK-491-97A : MNPNQKIITIGSICMVVGIISLMLQIGNIISVWVSPIIQAWHPNQPEPCNQS-------------------INFYTEQAAASVTLAGNSSLCPISGWAIYSKDNSIRIGS : 91 HK-503-97A : MNPNQKIITIGSICMVVGIISLMLQIGNIISVWVSHIIQAWHSNQPEPCNQS-------------------INFYTEQAAASVTLAGNSSLCPISGWAIYSKDNSIRIGS : 91 Ck-VN-HG4- : MNPNQKIITIGSICMVTGIVSLMLQVGNMISIWVSHSIHTGNQHQAEP--------------------ISNTNFLNEKAVASVKLAGNSSLCPINGWAVYSKDNSIRIGS : 90 Ck-VN-29-0 : MNPNQKIITIGSICMVTGIVSLMLQVGNMISIWVSHSIHTGNQHQAEP--------------------ISNTNLLTEKAVASVKIVGNSSLCPINGWAVYSKDNSIRIGS : 90 VN-HG-207- : MNPNQKIITIGSICMVTGIVSLMLQVGNMISIWVSHSIHTGNQHQAEP--------------------ISNTNFLNEKAVASVKLAGNSSLCPINGWAVYSKDNSIRIGS : 90 VN-HG-178- : MNPNQKIITIGSICMVTGIVSLMLQVGNMISIWVSHSIHTGNQHQAEP--------------------ISNTNFLTEKAVASVKLAGNSSLCPINGWAVYSKDNSIRIGS : 90 Ck-VN-CT-0 : MNPNQKIITIGSICMVTGIVNLMLQVGNMISIWVSHSIHTGNQHQAEP--------------------ISNTNFLTEKAVASVKLAGNSSLCPINGWAVYSKDNSIRIGS : 90 Ck-VN-TG-0 : MNPNQKIITIGSICMVTGIVNLMLQVGNMISIWVSHSIHTGNQHQAEP--------------------ISNTNFLTEKAVASVKLAGNSSLCPINGWAVYSKDNSIRIGS : 90 Ck-VN-DT-1 : MNPNQKIITIGSICMVTGIVSLMLQLGNMISIWVSHSIHTGNQHQAEP--------------------ISNTNFLTEKAVASVKLTGNSSLCPINGWAVYSKDNSIRIGS : 90 Ck-VN-30-0 : MNPNQKIITIGSICMVTGIVSLMLQVGNMISIWVSHSIHTGNQHQAEP--------------------ISNTNFLIEKAVASVKLAGNSSLCPINGWAVYSKDNSIRIGS : 90 Ck-VN-5-03 : MNPNQKIITIGSICMVTGIVSLMLQIGNMISIWVSHSIHTGNQHQAEP--------------------ISNTNFLTEKAVASVKLAGNSSLCPINGWAVYSKDNSIRIGS : 90 Dk-VN-11-0 : MNPNQKIITIGSICMVTGIVSLMLQIGNMISIWVSHSIHTGNQHQAEP--------------------ISNTNFLTEKAVASVKLAGNSSLCPINGWAVYSKDNSIRIGS : 90 Ck-VN-NCVD : MNPNQKIITIGSICMVTGIVSLMLQVGNMISIWVSHSIHTGNQHQAEP--------------------ISNTNFLTEKAVASVKLAGNSSLCPINGWAVYSKDNSIRIGS : 90 VN-CL2009- : MNPNQKIITIGSICMVTGIVSLMLQVGNMISIWVSHSINTGNQHQAEP--------------------ISNANFLTEKAVASVKLAGNSSLCPINGWAVYSKDNSIRIGS : 90 MDk-VN-145 : MNPNQKIITIGSICMVIGIVSLMLQIGNMISIWISHSIQTGNQHQVEP--------------------ISNTNFLTEKAVASVTLAGNSSLCPIRGWAVHSKDNSIRIGS : 90 Dk-VN-HaiP : MNPNQKIITIGSICMVIGIVSLMLQIGNMISIWVSHSIQTGNQHQAEP--------------------IRNTNFLTENAVASVTLAGNSSLCPIRGWAVHSKDNSIRIGS : 90 Dk-VN-50-0 : MNPNQKIITIGSICMVIGIVSLMLQIGNMISIWVSHSIQTGNQNQVEP--------------------IINTNFLTEKAVASITLAGNSSLCPIRGWAIHSKDNSIRIGS : 90 Dk-VN-BL-0 : MNPNQKIITIGSICMVTGIVSLMLQVGNMISIWVSHSIHTGNQHQAEP--------------------ISNTNFLTEKAVASVKLAGNSSLCPINGWAVYSKDNSIRIGS : 90 Dk-VN-17A- : MNPNQKIITIGSICMVTGIVSLMLQVGNMISIWVSHSIHTGNQHQAEP--------------------ISNTNFPTEKAVASAKLAGNSSLCPINGWAVYSKDNSIRIGS : 90 Ck-VN-NCVD : MNPNQKIITIGSICVVIGIVSLMLQIGNMISIWVSHSIQTENQCQAES--------------------ISNTKFLTEKAVASVTLMGNSSLCPISGWAVHSKDNSIRIGS : 90 Ck-Indo-BL : MNPNQKIITIGSICMVIGIVSVMLQIGNMISIWVSHSIQTGNQHQAES--------------------ISNTNPLTEKAVASVTLAGNSSLCPIRGWAVHSKDNSIRIGS : 90 Ck-Thailan : MNPNQKIITIGSICMVTGMVSLMLQIGNLISIWVSHSIHTGNQHKAEP--------------------ISNTNFLTEKAVASVKLAGNSSLCPINGWAVYSKDNSIRIGS : 90 Ck-TL-CK-1 : MNPNKKIITIGSICMVTGMVSLMLQIGNLISIWVSRSIHTGNQQKAEP--------------------ISNTNFLTEKAVASAKLAGNSSLCPINGWAVYSKDNSIRIGS : 90 Ck-Guangxi : MNPNQKIITIGSICMVIGIVSLMLQVGNMISIWVSHSIQTGNLNQVEP--------------------ISNTNFLTEKAVASVTLAGNSSLCPIRGWAIHSKDNSIRIGS : 90 Ck-TL-NP-1 : MNPNQKIITIGSICMVIGIVSLMLQIGNMISIWVSHSIQTGNQHQAEP--------------------IRNTNFLTENAVASVTLAGNSSLCPIRGWAVHSKDNSIRIGS : 90 Dk-TL-KU-5 : MNPNQKIITIGSICMVVGIVSLMLQIGNMISIWVSHSIQTGNQHQAEP--------------------IRNTNSLTENAVASVTLAGNSSLCPIRGWAVHSKDNSIRIGS : 90 Ck-Hunan-8 : MNPNQKIITIGSVCVIIGIVSLMLQIGNMISIWVSHSIQTGNQHQAEP--------------------IRNTNFLTESAVASVTLAGNSSLCPIRGWAVHSKDNSIRIGS : 90 Dk-Hubei-4 : MNPNRKIITIGSICMVIGIVSLMLQIGNIISIWVSHSIQTENQHQAEP--------------------ISNTNFLTEEAVASVTLAGNSSLCPISGWAVHSKDNGIRIGS : 90 Ck-India-N : MNPNQKIITIGSICMVIGIVSLMLQIGNVISIWVSHSVQTMNQRQAEP--------------------ISSSKFHAEKAVASVTLAGNSSLCPISGWAVYSKDNSIRIGS : 90 Các chủng Hồng Kông (1997) C ác ch ủ n g tr ư ớ c 20 03 C ác ch ủ n g 20 03 -2 0 09 C ác ch ủ n g tr ư ớ c 20 03 C ác ch ủ n g 20 03 -2 0 09 Phụ lục 7: SO SÁNH TRÌNH TỰ THÀNH PHẦN NUCLEOTIDE VÀ AMINO ACID CÁC GEN POLYMERASE GIỮA CHỦNG CKHG4 VỚI CÁC CHỦNG VIỆT NAM VÀ THẾ GIỚI (Dấu (.) biểu thị giống với nucleotide/amino acid của chủng CkHG4; sai khác của các chủng so với chủng CkHG4 biểu thị bằng chính ký hiệu nuleotide/chữ cái (1 chữ cái) của chúng) A. GEN PB2 a. Nucleotide (rút gọn) * 20 * 40 * 60 * 80 * 100 * Ck-VN-HG4- : ATGGAGAGAATAAAAGAATTACGAGATCTAATGTCACAGTCCCGCACTCGCGAGATACTAACAAAAACCACTGTGGACCATATGGCCATAATCAAGAAATACACATCAGGAAGACAAG : 118 Ck-VN-29-0 : ...................................................................................................................... : 118 Dk-HG-07-1 : ...................................................................................................................... : 118 Dk-VN-1771 : ...................................................................................................................... : 118 Ck-VN-CT-0 : ...................................................................................................................... : 118 Ck-VN-TG-0 : ...................................................................................................................... : 118 Dk-VN-1231 : ...................................................................................................................... : 118 Ck-VN-36-0 : ...................................................................................................................... : 118 VN-1203-04 : ...................................................................................................................... : 118 Ck-VN-NB-2 : .....................A.......................................................T...................................G.... : 118 Ck-VN-LS-2 : .....................A.......................................................T...................................G.... : 118 VN-CL2009- : ...................................................................................................................... : 118 Ck-VN-NCVD : ...................................................................................................................... : 118 Dk-VN-HaiP : .....................A.......................................................T...................................G.... : 118 MDk-VN-145 : ..................C..A.........................C...........G..................................................G....... : 118 Dk-VN-BL-0 : ..................C...................A............................................................................... : 118 Ck-VN-NCVD : ......................................A............................................................................... : 118 Dk-VN-50-0 : ------.......T.......A................................................................................................ : 112 Dk-Guangxi : .....................A.....T.......G.............................G..............C..A..T.......................T....... : 118 Ck-GD-178- : .....................A................................................................................................ : 118 Ck-Guangxi : .....................A................................................................................................ : 118 Ck-TL-NP-1 : .....................A................................................................................................ : 118 Ck-EastJav : .....................A................A..T............................................................................ : 118 Dk-TL-KU-5 : .....................A.........................A......................................A............................... : 118 Ck-Hunan-8 : .....A...............A................................................................................................ : 118 Ck-Laos-1- : .....................A.G..........................................................................G................... : 118 Dk-Hubei-4 : .....................A.....T.......G.............................G..............C.....T.......................T....... : 118 20 * 140 * 160 * 180 * 200 * 220 * Ck-VN-HG4- : AGAAGAACCCTGCTCTCAGAATGAAATGGATGATGGCAATGAAATATCCAATCACAGCGGACAAGAGAATAATAGAGATGATTCCTGAAAGGAATGAACAAGGGCAGACGCTCTGGAG : 236 Ck-VN-29-0 : ..................................................................................A................................... : 236 Dk-HG-07-1 : ..................................................................................A................................... : 236 Dk-VN-1771 : ...................................................................................................................... : 236 Ck-VN-CT-0 : ...................................................................................................................... : 236 Ck-VN-TG-0 : ...................................................................................................................... : 236 Dk-VN-1231 : ...................................................................................................................... : 236 Ck-VN-36-0 : ...................................................................................................................... : 236 VN-1203-04 : ...................................................................................................................... : 236 Ck-VN-NB-2 : ....A..T.........................................G.................................................................... : 236 Ck-VN-LS-2 : .......T.........................................G.................................................................... : 236 VN-CL2009- : ..............................................C....................................................................... : 236 Ck-VN-NCVD : ...................................................................................................................... : 236 Dk-VN-HaiP : .......T.........................................G.................................................................... : 236 MDk-VN-145 : .A...........C............................................A..............G........C......C..........G..A..A.....T..... : 236 Dk-VN-BL-0 : ..........................................................A.......................C................................... : 236 Ck-VN-NCVD : ..........................................................A.......................C................................... : 236 Dk-VN-50-0 : .......T......................................C..G..........................A.....C................................... : 230 Dk-Guangxi : ..............................................C.....A.....A..............G................................A.....T..... : 236 Ck-GD-178- : .............................................................T........................................................ : 236 Ck-Guangxi : .................................................G.................................................................... : 236 Ck-TL-NP-1 : .......T.........................................G.................................................................... : 236 Ck-EastJav : .............................................................T........................................................ : 236 Dk-TL-KU-5 : .......T........A................................G.................................................................... : 236 Ck-Hunan-8 : .......T...................................G.....G.................................................................... : 236 Ck-Laos-1- : ........................................................................C............................................. : 236 Dk-Hubei-4 : ..............................................C.....A.....A..............G................................A.....T..... : 236 * 960 * 980 * 1000 * 1020 * 1040 * 1060 Ck-VN-HG4- : GGGTCTGAGGATCAGTTCTTCCTTTAGCTTTGGAGGCTTCACTTTCAAAAGAACAAGTGGATCATCCGTCAAGAAGGAAGAGGAAGTGCTTACAGGCAACCTCCAAACATTGAAAATA : 1062 Ck-VN-29-0 : ...................................................................A......................C........................... : 1062 Dk-HG-07-1 : ....A..............................................................A......................C........................... : 1062 Dk-VN-1771 : ...................................................................A.................................................. : 1062 Ck-VN-CT-0 : ...................................................................................................................... : 1062 Ck-VN-TG-0 : ...................................................................................................................... : 1062 Dk-VN-1231 : ...................................................................A.................................................. : 1062 Ck-VN-36-0 : ...................................................................................................................... : 1062 VN-1203-04 : ......T............................................................................................................... : 1062 Ck-VN-NB-2 : ..................A.................T..................................C.....................G........................ : 1062 Ck-VN-LS-2 : ..................A.................T..................................C.....................G........................ : 1062 VN-CL2009- : .......................................................................................A.............................. : 1062 Ck-VN-NCVD : ....A..............................................G...............A.................................................. : 1062 Dk-VN-

Các file đính kèm theo tài liệu này:

  • pdfvsvhty_la_tran_quang_vui_6001_2005435.pdf
Tài liệu liên quan